PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003375P4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 378aa    MW: 42511.9 Da    PI: 6.5095
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003375P4genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.2e-27136188255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     ++++WtpeLH++Fv+aveqL G+++A+P++ilelmkv+gLt+++++SHLQkYR+
  MELO3C003375P4 136 TKVDWTPELHRKFVQAVEQL-GIDHAIPSKILELMKVEGLTRHNIASHLQKYRM 188
                     5899****************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.436132191IPR017930Myb domain
SuperFamilySSF466891.34E-18134192IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-26136191IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-25137189IPR006447Myb domain, plants
PfamPF002493.5E-8138187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MQLQLENEDK NGVPEDMEIL SWIQDIVWEQ PEGSDDKSQL NLGASRQGSW ESGDQMNCSM  60
ETDCKDKDVQ SKFVETTSHD LVCEGPIQEG QPQLSDKKKF GVESDPLAAE NSIQGTGVNQ  120
SAGSKAKKTK VKLSDTKVDW TPELHRKFVQ AVEQLGIDHA IPSKILELMK VEGLTRHNIA  180
SHLQKYRMQK KHVMQREENT RWSHYPRSTL QTNHLKPIMA YPSYHPNCGI SVSAVYPTWR  240
QTNDRPPNIH VCGPFGYRHW PQPGIQPWNS YARVQADTWG CPVMPPSHAP YFSYPQLVSA  300
SQHNMHTVNK SYGMPQGLFD LQPDEEVVDK IVKEAMREPW SPLPLGLKPP STESVLTELS  360
KQGISTVPPQ IDGSRSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-15137193763ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU1792040.0KU179204.1 Cucumis sativus cultivar W33 two-component response regulator-like protein APRR2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008465932.10.0PREDICTED: two-component response regulator-like APRR2 isoform X2
TrEMBLA0A140CWL00.0A0A140CWL0_CUCSA; Two-component response regulator-like protein APRR2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.66e-47ARR-B family protein